PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc00428.1.g00040.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family MYB
Protein Properties Length: 537aa    MW: 59011.1 Da    PI: 9.9667
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc00428.1.g00040.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.33.6e-18265312148
                                   TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
               Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                                   +g+WT+eEd++l+ +++q+G g+W++ +++ g+ R++k+c++rw +yl
  Zmw_sc00428.1.g00040.1.am.mk 265 KGPWTPEEDQKLLAYIEQHGHGCWRSLPAKAGLQRCGKSCRLRWTNYL 312
                                   79********************************************97 PP

2Myb_DNA-binding52.31.3e-16318363148
                                   TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
               Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                                   rg+++ +E++ +++++++lG++ W++Ia +++ +Rt++++k++w+++l
  Zmw_sc00428.1.g00040.1.am.mk 318 RGKFSLQEEQTIIQLHALLGNR-WSAIATHLP-KRTDNEIKNYWNTHL 363
                                   89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.5E-26256315IPR009057Homeodomain-like
PROSITE profilePS5129419.026260312IPR017930Myb domain
SuperFamilySSF466891.01E-29262359IPR009057Homeodomain-like
SMARTSM007171.3E-14264314IPR001005SANT/Myb domain
PfamPF002492.7E-16265312IPR001005SANT/Myb domain
CDDcd001677.82E-12267312No hitNo description
PROSITE profilePS5129425.891313367IPR017930Myb domain
Gene3DG3DSA:1.10.10.606.3E-26316367IPR009057Homeodomain-like
SMARTSM007171.2E-16317365IPR001005SANT/Myb domain
PfamPF002497.2E-16318363IPR001005SANT/Myb domain
CDDcd001671.90E-11320363No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 537 aa     Download sequence    Send to blast
MHMCHDDRHI DDAFRPAVTV SWNGFRRRIV RSCITVAWRL GEWFSASSGR SSVDRERKHM  60
QQQQRRRRHR STTRMPSSWE RARHPYGVHL TVQERDATNS PGIWTIGGGA EPHPSGERPQ  120
ELNAHPLSGG SRSAATVPRR RGSERREPVV VHRAEHAPEG NPRSALARTA GTLTSRPRRA  180
GIAVQEEDIA PRPAATPLFM PHSRLTPTST PTSKGQGNHH TSAPACCQKG QDLSQSIALI  240
DWGAIKGKRT GMGRSPCCEK EGLKKGPWTP EEDQKLLAYI EQHGHGCWRS LPAKAGLQRC  300
GKSCRLRWTN YLRPDIKRGK FSLQEEQTII QLHALLGNRW SAIATHLPKR TDNEIKNYWN  360
THLKKRLAKM GIDPVTHKPR SDTLAAGGGG AQHAKAAAHL SHTAQWESAR LEAEARLAXX  420
XXAAAARAAL QPMQAFEEEA CGNKEQQHWG DVDVADAGFA GVGFTGLLLD GSLSQEDLRP  480
AAGRDHGGAD AGLQETEEDN NYWNSILNLV NSSAATASMP TSAVAPVAEA YSPALEF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-252633675108B-MYB
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
15467RERKHMQQQQRRRR
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004975862.11e-136PREDICTED: myb-related protein Myb4-like
TrEMBLK3Y8111e-136K3Y811_SETIT; Uncharacterized protein
STRINGSi010352m1e-136(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP7938563